訂貨：/

品牌：BioInnovatise

現(xiàn)貨：10ug

Catalog Number: 2010002
Source: E. coli-derived
Amino Acid Sequence: MHKCDITLQEIIKTLNSLTEQKTLCTVTDIFAASKNTTEKETFCRAATVL RQFYSHHEKDTRCLGATAFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Predicted Molecular Weight: ~15.1 kDa.
Package size: 10 ?ug, 50 ?ug, 1 mg
Description: Interleukin4 （IL-4）, also known as B cell stimulatory factor1, is a monomeric Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intra-chain disulfide bridges and adopts a bundled four α-helix structure. IL4 exerts its effects through two receptor （type I receptor and type II receptor） complexes. IL4 is primarily expressed by Th2 biased CD4+ T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG4 and IgE in human B cells, acquisition of the Th2 phenotype by naïve CD4+ T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL4 plays a dominant role in the development of allergic inflammation and asthma.
Biological Activity: Measured in a cell proliferation assay using TF1 human erythroleukemic cells. Kitamura, T. et al. （1989） J. Cell Physiol. 140:323. The ED50 for this effect is typically 0.05 0.2 ng/mL.
Endotoxin Level: <1.0 EU per 1 μg of the protein by the LAL method.
Purity: >98%, by SDS-PAGE analysis under reducing conditions and visualized by Commassie stain.
Purification notes: Recombinant hIL-4 was purified by affinity chromatography and FPLC after refolding of the isolated inclusion bodies in a renaturation buffer.
Formulation: Lyophilized from a 0.2 μm filtered solution in PBS with no calcium, magnesium, or preservatives.
Reconstitution: Reconstitute at 100 μg/mL in sterile dH2O.
Suggested Working Dilutions: The optimal concentration should be determined for each specific application.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediay at
-20°C or -80°C freezer.
Stability & Storage: 12 months from date of receipt. Stored in a manual defrost -20°C or -80°C freezer and avoid repeated freeze thaw cycles.
Country of Origin: Made in USA.